GDI2 (NM_001494) Human Mass Spec Standard
CAT#: PH300596
GDI2 MS Standard C13 and N15-labeled recombinant protein (NP_001485)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200596 |
Predicted MW | 50.7 kDa |
Protein Sequence |
>RC200596 protein sequence
Red=Cloning site Green=Tags(s) MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGR DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRF RKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIK LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQL ICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYI AIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI YKRMTGSEFDFEEMKRKKNDIYGED myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001485 |
RefSeq Size | 2441 |
RefSeq ORF | 1335 |
Synonyms | HEL-S-46e; RABGDIB |
Locus ID | 2665 |
UniProt ID | P50395, Q6IAT1 |
Cytogenetics | 10p15.1 |
Summary | GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400572 | GDI2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426526 | GDI2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400572 | Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 1 |
USD 436.00 |
|
LY426526 | Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 2 |
USD 436.00 |
|
TP300596 | Recombinant protein of human GDP dissociation inhibitor 2 (GDI2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review