ARPC2 (NM_005731) Human Mass Spec Standard
CAT#: PH300319
ARPC2 MS Standard C13 and N15-labeled recombinant protein (NP_005722)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200319 |
Predicted MW | 34.3 kDa |
Protein Sequence |
>RC200319 protein sequence
Red=Cloning site Green=Tags(s) MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAH GADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGEN RAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELK DTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRA RPDAEKKEMKTITGKTFSSR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005722 |
RefSeq Size | 1419 |
RefSeq ORF | 900 |
Synonyms | ARC34; p34-Arc; PNAS-139; PRO2446 |
Locus ID | 10109 |
UniProt ID | O15144, Q53R19 |
Cytogenetics | 2q35 |
Summary | This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008] |
Protein Pathways | Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407180 | ARPC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC417111 | ARPC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407180 | Transient overexpression lysate of actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 1 |
USD 436.00 |
|
LY417111 | Transient overexpression lysate of actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2 |
USD 436.00 |
|
TP300319 | Recombinant protein of human actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review