Menin (MEN1) (NM_130799) Human Mutant ORF Clone

CAT#: RC403512

MEN1 Mutant (E26X), Myc-DDK-tagged ORF clone of Homo sapiens multiple endocrine neoplasia I (MEN1), transcript variant 2 as transfection-ready DNA

Specifications

Product Data

• Mutation Description: E26X
• Affected Codon#: 26
• Affected NT#: 76
• Tag: Myc-DDK
• Effect: Multiple endocrine neoplasia 1
• Symbol: MEN1
• Synonyms: MEAI; SCG2
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Vector: pCMV6-Entry
• ACCN: NM_130799
• ORF Size: 75 bp
• Sequence Data:
  ORF Nucleotide Sequence

  >RC403512 representing NM_130799
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGGCTGAAGGCCGCCCAGAAGACGCTGTTCCCGCTGCGCTCCATCGACGACGTGGTGCGCCTGTTTG
  CTGCC
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGA TAAGGTTTAA
  Protein Sequence

  >RC403512 representing NM_130799
  Red=Cloning site Green=Tags(s)
  
  MGLKAAQKTLFPLRSIDDVVRLFAA
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).

Reference Data

• RefSeq: NP_570711
• RefSeq Size: 75 bp
• RefSeq ORF: 1833 bp
• Locus ID: 4221
• Cytogenetics: 11q13.1
• Domains: Menin
• Protein Families: Druggable Genome, Transcription Factors
• MW: 2.8 kDa
• Gene Summary: This gene encodes menin, a tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. Menin is a scaffold protein that functions in histone modification and epigenetic gene regulation. It is thought to regulate several pathways and processes by altering chromatin structure through the modification of histones. [provided by RefSeq, May 2019]