MSH6 (NM_000179) Human Mutant ORF Clone

CAT#: RC401392

MSH6 Mutant (S200X), Myc-DDK-tagged ORF clone of Homo sapiens mutS homolog 6 (E. coli) (MSH6) as transfection-ready DNA

Specifications

Product Data

• Mutation Description: S200X
• Affected Codon#: 200
• Affected NT#: 599
• Tag: Myc-DDK
• Effect: Colorel ner
• Symbol: MSH6
• Synonyms: GTBP; GTMBP; HNPCC5; HSAP; MMRCS3; p160
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Vector: pCMV6-Entry
• ACCN: NM_000179
• ORF Size: 597 bp
• Sequence Data:
  ORF Nucleotide Sequence

  >RC401392 representing NM_000179
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCGCGACAGAGCACCCTGTACAGCTTCTTCCCCAAGTCTCCGGCGCTGAGTGATGCCAACAAGGCCT
  CGGCCAGGGCCTCACGCGAAGGCGGCCGTGCCGCCGCTGCCCCCGGGGCCTCTCCTTCCCCAGGCGGGGA
  TGCGGCCTGGAGCGAGGCTGGGCCTGGGCCCAGGCCCTTGGCGCGCTCCGCGTCACCGCCCAAGGCGAAG
  AACCTCAACGGAGGGCTGCGGAGATCGGTAGCGCCTGCTGCCCCCACCAGTTGTGACTTCTCACCAGGAG
  ATTTGGTTTGGGCCAAGATGGAGGGTTACCCCTGGTGGCCTTGTCTGGTTTACAACCACCCCTTTGATGG
  AACATTCATCCGCGAGAAAGGGAAATCAGTCCGTGTTCATGTACAGTTTTTTGATGACAGCCCAACAAGG
  GGCTGGGTTAGCAAAAGGCTTTTAAAGCCATATACAGGTTCAAAATCAAAGGAAGCCCAGAAGGGAGGTC
  ATTTTTACAGTGCAAAGCCTGAAATACTGAGAGCAATGCAACGTGCAGATGAAGCCTTAAATAAAGACAA
  GATTAAGAGGCTTGAATTGGCAGTTTGTGATGAGCCC
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGA TAAGGTTTAA
  Protein Sequence

  >RC401392 representing NM_000179
  Red=Cloning site Green=Tags(s)
  
  MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAK
  NLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTR
  GWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEP
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).

Reference Data

• RefSeq: NP_000170
• RefSeq Size: 597 bp
• RefSeq ORF: 4083 bp
• Locus ID: 2956
• Cytogenetics: 2p16.3
• Domains: PWWP, MutS_V, MutS_I, MutS_III, MutS_II, MutS_IV
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Colorectal cancer, Mismatch repair, Pathways in cancer
• MW: 21.9 kDa
• Gene Summary: This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described. [provided by RefSeq, Jul 2013]