FH (NM_000143) Human Mutant ORF Clone

CAT#: RC401079

  • TrueORF®

FH Mutant (R101X), Myc-DDK-tagged ORF clone of Homo sapiens fumarate hydratase (FH), nuclear gene encoding mitochondrial protein as transfection-ready DNA


Reconstitution Protocol

USD 225.00

2 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Mutation Description R101X
Affected Codon# 101
Affected NT# 301
Tag Myc-DDK
Effect Muliple leiomyomosis
Symbol FH
Synonyms FMRD; HLRCC; HsFH; LRCC; MCL; MCUL1
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Vector pCMV6-Entry
ACCN NM_000143
ORF Size 300 bp
Sequence Data
>RC401079 representing NM_000143
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACCGAGCACTTCGGCTCCTCGCGCGCTCGCGTCCCCTCGTGCGGGCTCCAGCCGCAGCCTTAGCTT
CGGCTCCCGGCTTGGGTGGCGCGGCCGTGCCCTCGTTTTGGCCTCCGAACGCGGCTCGAATGGCAAGCCA
AAATTCCTTCCGGATAGAATATGATACCTTTGGTGAACTAAAGGTGCCAAATGATAAGTATTATGGCGCC
CAGACCGTGAGATCTACGATGAACTTTAAGATTGGAGGTGTGACAGAACGCATGCCAACCCCAGTTATTA
AAGCTTTTGGCATCTTGAAG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC401079 representing NM_000143
Red=Cloning site Green=Tags(s)

MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGA
QTVRSTMNFKIGGVTERMPTPVIKAFGILK

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NP_000134
RefSeq Size 300 bp
RefSeq ORF 1533 bp
Locus ID 2271
Cytogenetics 1q43
Domains lyase_1
Protein Families Druggable Genome
Protein Pathways Citrate cycle (TCA cycle), Metabolic pathways, Pathways in cancer, Renal cell carcinoma
MW 11 kDa
Gene Summary The protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy. [provided by RefSeq, Jul 2008]

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.