core protein C (NC_001563) Virus Tagged ORF Clone
CAT#: VC102502
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776010
View other clones from "Virus" (11)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | core protein C |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102502 represents NCBI reference of NP_776010 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGAGCAAAAAGCCAGGAGGTCCAGGAAAAAATAGAGCTGTCAACATGCTTAAGAGGGGGATGCCAA GAGGATTGAGCTTGATTGGCCTGAAGCGGGCAATGCTGTCCCTTATTGACGGGAAGGGTCCTATCAGGTT CGTGCTGGCACTGCTGGCCTTTTTTCGCTTCACAGCCATCGCGCCCACCAGGGCCGTGTTGGATAGATGG CGAGGTGTCAATAAACAGACAGCTATGAAGCATCTTCTGTCATTTAAAAAAGAACTCGGGACACTGACCA GCGCTATCAATCGGCGCAGCACTAAGCAGAAGAAGCGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102502 representing NP_776010
Red=Cloning sites Green=Tags MMSKKPGGPGKNRAVNMLKRGMPRGLSLIGLKRAMLSLIDGKGPIRFVLALLAFFRFTAIAPTRAVLDRW RGVNKQTAMKHLLSFKKELGTLTSAINRRSTKQKKR TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001563 |
ORF Size | 318 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_001563.2, NP_776010 |
RefSeq ORF | 318 bp |
MW | 11.8 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102503 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776011 |
USD 225.00 |
|
VC102504 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776012 |
USD 330.00 |
|
VC102505 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776013 |
USD 165.00 |
|
VC102506 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776014 |
USD 503.00 |
|
VC102507 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776015 |
USD 503.00 |
|
VC102508 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776016 |
USD 330.00 |
|
VC102509 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776017 |
USD 165.00 |
|
VC102510 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776018 |
USD 635.00 |
|
VC102511 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776019 |
USD 165.00 |
|
VC102512 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776020 |
USD 165.00 |
|
VC102513 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [West Nile virus], codon optimized for human cell expression, NP_776021 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review