JPH3 (NM_001271605) Human Tagged ORF Clone

CAT#: RG233315

JPH3 (tGFP-tagged) - Homo sapiens junctophilin 3 (JPH3), transcript variant 3

Product Images

Circular map for RG233315

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: JPH3
• Synonyms: CAGL237; HDL2; JP-3; JP3; TNRC22
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG233315 representing NM_001271605
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCAGTGGGGGCAGGTTTAATTTTGACGACGGAGGGTCCTACTGTGGAGGCTGGGAGGACGGCAAGG
  CGCACGGCCATGGCGTCTGCACCGGCCCCAAGGGCCAAGGCGAATACACCGGCTCGTGGAGCCACGGCTT
  CGAGGTGCTGGGCGTCTACACCTGGCCCAGCGGCAACACGTACCAGGGCACCTGGGCGCAGGGCAAGCGC
  CACGGCATCGGCCTGGAGAGCAAGGGGAAGTGGGTGTACAAGGGCGAGTGGACGCACGGATTCAAGGGGC
  GCTACGGGGTGCGGGAGTGCGCGGGCAACGGGGCCAAATACGAAGGGACCTGGAGCAACGGGCTGCAGGA
  CGGCTACGGGACCGAGACCTACTCGGACGGAGGTGGTTGGACGCGGACTAGCGCTGTCGAAGCAGGCTGC
  TGGAGGGAGGAGGGAGGCCCATCTGCTCAG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG233315 representing NM_001271605
  Red=Cloning site Green=Tags(s)
  
  MSSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKR
  HGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGGWTRTSAVEAGC
  WREEGGPSAQ
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001271605
• ORF Size: 450 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001271605.2
• RefSeq Size: 1238 bp
• RefSeq ORF: 453 bp
• Locus ID: 57338
• Cytogenetics: 16q24.2
• Protein Families: Druggable Genome, Transmembrane
• Gene Summary: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. CAG/CTG repeat expansion from normally 6-28 repeats to 40-59 repeats in the 3' UTR of this gene have been associated with Huntington disease-like 2 (HDL2). This gene is a member of the junctophilin gene family. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2016]