ENY2 (NM_001193557) Human Tagged ORF Clone

CAT#: RG230760

  • TrueORF®

ENY2 (tGFP-tagged) - Human enhancer of yellow 2 homolog (Drosophila) (ENY2), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001193557" in other vectors (3)

Reconstitution Protocol

USD 365.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


ENY2 Antibody - N-terminal region
    • 100 ul

USD 539.00

Other products for "ENY2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ENY2
Synonyms DC6; e(y)2; Sus1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG230760 representing NM_001193557
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGTTAGCAAGATGAACAAAGATGCGCAGATGAGAGCAGCGATTAACCAAAAGTTGATAGAAACTG
GAGAAAGAGAACGCCTCAAAGAGTTGCTGAGAGCTAAATTAATTGAATGTGGCTGGAAGGATCAGTTGAA
GGCACACTGTAAAGAGGTAATTAAAGAAAAAGGACTAGAACACGTTACTGTTGATGACTTGGTGGCTGAA
ATCACTCCAAAAGGCAGAGCCCTGGTACCTGACAGTGTAAAGAAGGAGCTCCTACAAAGAATAAGAACAT
TCCTTGCTCAGCATGCCAGCCTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG230760 representing NM_001193557
Red=Cloning site Green=Tags(s)

MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAE
ITPKGRALVPDSVKKELLQRIRTFLAQHASL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001193557
ORF Size 306 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001193557.1, NP_001180486.1
RefSeq Size 2876 bp
RefSeq ORF 291 bp
Locus ID 56943
UniProt ID Q9NPA8
Cytogenetics 8q23.1
Gene Summary Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation (PubMed:18206972, PubMed:21746879). As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores (PubMed:23591820).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.