RNF4 (NM_001185010) Human Tagged ORF Clone

CAT#: RG229544

RNF4 (tGFP-tagged) - Human ring finger protein 4 (RNF4), transcript variant 3

Product Images

Circular map for RG229544

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: RNF4
• Synonyms: RES4-26; SLX5; SNURF
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG229544 representing NM_001185010
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTACAAGAAAGCGTCGTGGTGGAGCAATAAATTCTAGACAAGCTCAGAAGCGAACTCGGGAAGCAA
  CCTCCACCCCCGAGATCTCCTTGGAAGCAGAACCCATAGAACTCGTGGAAACTGCTGGAGATGAAATTGT
  GGACCTCACTTGTGAATCTTTAGAGCCTGTGGTGGTTGATCTGACTCACAATGACTCTGTTGTGATTGTT
  GACGGCCCTCAGGTACTGTCAGTTGTCCCATCTGCATGGACGGATACTCAGAGATCGTGCAGAATGGACG
  TCTCATCGTTTCCACAGAATGCGGCCATGTCTTCTGTAGCCAGTGCCTCCGTGATTCCC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG229544 representing NM_001185010
  Red=Cloning site Green=Tags(s)
  
  MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIV
  DGPQVLSVVPSAWTDTQRSCRMDVSSFPQNAAMSSVASASVIP
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001185010
• ORF Size: 339 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001185010.3
• RefSeq Size: 2811 bp
• RefSeq ORF: 342 bp
• Locus ID: 6047
• UniProt ID: P78317
• Cytogenetics: 4p16.3
• Protein Families: Transcription Factors
• Gene Summary: The protein encoded by this gene contains a RING finger motif and acts as a transcription regulator. This protein has been shown to interact with, and inhibit the activity of, TRPS1, a transcription suppressor of GATA-mediated transcription. Transcription repressor ZNF278/PATZ is found to interact with this protein, and thus reduce the enhancement of androgen receptor-dependent transcription mediated by this protein. Studies of the mouse and rat counterparts suggested a role of this protein in spermatogenesis. A pseudogene of this gene is found on chromosome 1.[provided by RefSeq, Jul 2010]