Lunatic Fringe(LFNG) (NM_001040168) Human Tagged ORF Clone

CAT#: RG223354

LFNG (GFP-tagged) - Human LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (LFNG), transcript variant 2

Change vector?

  • TrueORF®

USD 495.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Lunatic Fringe(LFNG) (NM_001040168) Human Tagged ORF Clone
Symbol LFNG
Synonyms SCDO3
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG223354 representing NM_001040168
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCAAGCGCTGCGGCCGGCGCCTGCTGCTGGCGCTGGCGGGCGCGCTGCTCGCCTGCCTGCTGGTGC
TCACCGCCGACCCGCCGCCGCCTCCACTGCCCGCCGAGCGCGGCCGGCGCGCGCTGCGCAGCCTGGCGGG
CCCCGCGGGGGCTGCCCCGGCGCCCGGGCTGGGGGCGGCGGCGGCGGCGCCCGGGGCGCTGGTCCGCGAC
GTGCACAGTCTGTCCGAGTACTTCAGCCTGCTCACCCGCGCGCGCAGAGATGCGGGCCCGCCGCCCGGGG
CTGCCCCCCGCCCCGCCGACGGCCACCCGCGCCCCCTGGCCGAGCCGCTCGCGCCCCGAGACGTCTTCAT
CGCTGTCAAGACCACCAAAAAGTTCCACCGCGCGCGCCTCGACCTGCTGCTGGAGACCTGGATCTCGCGC
CACAAGGAGATGACGTTCATCTTCACTGACGGGGAAGATGAGGCCCTGGCCAGGCACACGGGCAACGTGG
TCATCACAAACTGCTCGGCCGCCCACAGCCGCCAGGCGCTGTCCTGCAAGATGGCCGTGGAGTATGACCG
CTTCATCGAGTCCGGCAGGAAGTGGTTCTGCCACGTGGACGATGACAACTACGTCAACCTGCGGGCCCTG
CTGCGGCTGCTGGCCAGCTACCCGCACACGCGGGACGTCTACGTCGGCAAGCCCAGCCTGGACAGGCCCA
TCCAGGCCATGGAGCGGGTCAGCGAGAACAAGGTGCGTCCTGTCCACTTCTGGTTTGCCACGGGCGGCGC
TGGCTTCTGCATCAGCCGTGGGCTGGCTCTGAAGATGAGCCCGTGGGCCAGCGGGGGTCACTTCATGAAT
ACGGCTGAGCGGATCCGGCTGCCTGATGACTGCACCATCGGCTACATCGTGGAGGCCCTGCTGGGTGTGC
CCCTCATCCGCAGCGGCCTCTTCCACTCCCACCTGGAGAACCTGCAGCAGGTGCCCACCTCGGAGCTCCA
CGAGCAGGTGACGCTGAGCTACGGTATGTTTGAAAACAAGCGGAACGCCGTCCACGTGAAGGGGCCCTTC
TCGGTGGAGGCCGACCCATCCAGGTGGGGAAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG223354 representing NM_001040168
Red=Cloning site Green=Tags(s)

MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSLAGPAGAAPAPGLGAAAAAPGALVRD
VHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTKKFHRARLDLLLETWISR
HKEMTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRAL
LRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMN
TAERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPF
SVEADPSRWGN

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001040168
ORF Size 1083 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001040168.1, NP_001035258
RefSeq Size 1403
Locus ID 3955
Cytogenetics 7p22.3
Protein Families Transmembrane
Protein Pathways Notch signaling pathway
Gene Summary This gene is a member of the fringe gene family which also includes radical and manic fringe genes. They all encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. This gene product is predicted to be a single-pass type II Golgi membrane protein but it may also be secreted and proteolytically processed like the related proteins in mouse and Drosophila (PMID: 9187150). Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.