CD11a (ITGAL) (NM_002209) Human Tagged ORF Clone

CAT#: RG221297

Reviews ()
Write a review
  • TrueORF®

ITGAL (GFP-tagged) - Human integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) (ITGAL), transcript variant 1



  "NM_002209" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,218.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ITGAL"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ITGAL
Synonyms CD11A; LFA-1; LFA1A
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG221297 representing NM_002209
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGATTCCTGCATCACTGTGATGGCCATGGCGCTGCTGTCTGGGTTCTTTTTCTTCGCGCCGGCCT
CGAGCTACAACCTGGACGTGCGGGGCGCGCGGAGCTTCTCCCCACCGCGCGCCGGGAGGCACTTTGGATA
CCGCGTCCTGCAGGTCGGAAACGGGGTCATCGTGGGAGCTCCAGGGGAGGGGAACAGCACAGGAAGCCTC
TATCAGTGCCAGTCGGGCACAGGACACTGCCTGCCAGTCACCCTGAGAGGTTCCAACTATACCTCCAAGT
ACTTGGGAATGACCTTGGCAACAGACCCCACAGATGGAAGCATTTTGGCCTGTGACCCTGGGCTGTCTCG
AACGTGTGACCAGAACACCTATCTGAGTGGCCTGTGTTACCTCTTCCGCCAGAATCTGCAGGGTCCCATG
CTGCAGGGGCGCCCTGGTTTTCAGGAATGTATCAAGGGCAACGTAGACCTGGTATTTCTGTTTGATGGTT
CGATGAGCTTGCAGCCAGATGAATTTCAGAAAATTCTGGACTTCATGAAGGATGTGATGAAGAAACTCAG
CAACACTTCGTACCAGTTTGCTGCTGTTCAGTTTTCCACAAGCTACAAAACAGAATTTGATTTCTCAGAT
TATGTTAAATGGAAGGACCCTGATGCTCTGCTGAAGCATGTAAAGCACATGTTGCTGTTGACCAATACCT
TTGGTGCCATCAATTATGTCGCGACAGAGGTGTTCCGGGAGGAGCTGGGGGCCCGGCCAGATGCCACCAA
AGTGCTTATCATCATCACGGATGGGGAGGCCACTGACAGTGGCAACATCGATGCGGCCAAAGACATCATC
CGCTACATCATCGGGATTGGAAAGCATTTTCAGACCAAGGAGAGTCAGGAGACCCTCCACAAATTTGCAT
CAAAACCCGCGAGCGAGTTTGTGAAAATTCTGGACACATTTGAGAAGCTGAAAGATCTATTCACTGAGCT
GCAGAAGAAGATCTATGTCATTGAGGGCACAAGCAAACAGGACCTGACTTCCTTCAACATGGAGCTGTCC
TCCAGCGGCATCAGTGCTGACCTCAGCAGGGGCCATGCAGTCGTGGGGGCAGTAGGAGCCAAGGACTGGG
CTGGGGGCTTTCTTGACCTGAAGGCAGACCTGCAGGATGACACATTTATTGGGAATGAACCATTGACACC
AGAAGTGAGAGCAGGCTATTTGGGTTACACCGTGACCTGGCTGCCCTCCCGGCAAAAGACTTCGTTGCTG
GCCTCGGGAGCCCCTCGATACCAGCACATGGGCCGAGTGCTGCTGTTCCAAGAGCCACAGGGCGGAGGAC
ACTGGAGCCAGGTCCAGACAATCCATGGGACCCAGATTGGCTCTTATTTCGGTGGGGAGCTGTGTGGCGT
CGACGTGGACCAAGATGGGGAGACAGAGCTGCTGCTGATTGGTGCCCCACTGTTCTATGGGGAGCAGAGA
GGAGGCCGGGTGTTTATCTACCAGAGAAGACAGTTGGGGTTTGAAGAAGTCTCAGAGCTGCAGGGGGACC
CCGGCTACCCACTCGGGCGGTTTGGAGAAGCCATCACTGCTCTGACAGACATCAACGGCGATGGGCTGGT
AGACGTGGCTGTGGGGGCCCCTCTGGAGGAGCAGGGGGCTGTGTACATCTTCAATGGGAGGCACGGGGGG
CTTAGTCCCCAGCCAAGTCAGCGGATAGAAGGGACCCAAGTGCTCTCAGGAATTCAGTGGTTTGGACGCT
CCATCCATGGGGTGAAGGACCTTGAAGGGGATGGCTTGGCAGATGTGGCTGTGGGGGCTGAGAGCCAGAT
GATCGTGCTGAGCTCCCGGCCCGTGGTGGATATGGTCACCCTGATGTCCTTCTCTCCAGCTGAGATCCCA
GTGCATGAAGTGGAGTGCTCCTATTCAACCAGTAACAAGATGAAAGAAGGAGTTAATATCACAATCTGTT
TCCAGATCAAGTCTCTCTACCCCCAGTTCCAAGGCCGCCTGGTTGCCAATCTCACTTACACTCTGCAGCT
GGATGGCCACCGGACCAGAAGACGGGGGTTGTTCCCAGGAGGGAGACATGAACTCAGAAGGAATATAGCT
GTCACCACCAGCATGTCATGCACTGACTTCTCATTTCATTTCCCGGTATGTGTTCAAGACCTCATCTCCC
CCATCAATGTTTCCCTGAATTTCTCTCTTTGGGAGGAGGAAGGGACACCGAGGGACCAAAGGGCGCAGGG
CAAGGACATACCGCCCATCCTGAGACCCTCCCTGCACTCGGAAACCTGGGAGATCCCTTTTGAGAAGAAC
TGTGGGGAGGACAAGAAGTGTGAGGCAAACTTGAGAGTGTCCTTCTCTCCTGCAAGATCCAGAGCCCTGC
GTCTAACTGCTTTTGCCAGCCTCTCTGTGGAGCTGAGCCTGAGTAACTTGGAAGAAGATGCTTACTGGGT
CCAGCTGGACCTGCACTTCCCCCCGGGACTCTCCTTCCGCAAGGTGGAGATGCTGAAGCCCCATAGCCAG
ATACCTGTGAGCTGCGAGGAGCTTCCTGAAGAGTCCAGGCTTCTGTCCAGGGCATTATCTTGCAATGTGA
GCTCTCCCATCTTCAAAGCAGGCCACTCGGTTGCTCTGCAGATGATGTTTAATACACTGGTAAACAGCTC
CTGGGGGGACTCGGTTGAATTGCACGCCAATGTGACCTGTAACAATGAGGACTCAGACCTCCTGGAGGAC
AACTCAGCCACTACCATCATCCCCATCCTGTACCCCATCAACATCCTCATCCAGGACCAAGAAGACTCCA
CACTCTATGTCAGTTTCACCCCCAAAGGCCCCAAGATCCACCAAGTCAAGCACATGTACCAGGTGAGGAT
CCAGCCTTCCATCCACGACCACAACATACCCACCCTGGAGGCTGTGGTTGGGGTGCCACAGCCTCCCAGC
GAGGGGCCCATCACACACCAGTGGAGCGTGCAGATGGAGCCTCCCGTGCCCTGCCACTATGAGGATCTGG
AGAGGCTCCCGGATGCAGCTGAGCCTTGTCTCCCCGGAGCCCTGTTCCGCTGCCCTGTTGTCTTCAGGCA
GGAGATCCTCGTCCAAGTGATCGGGACTCTGGAGCTGGTGGGAGAGATCGAGGCCTCTTCCATGTTCAGC
CTCTGCAGCTCCCTCTCCATCTCCTTCAACAGCAGCAAGCATTTCCACCTCTATGGCAGCAACGCCTCCC
TGGCCCAGGTTGTCATGAAGGTTGACGTGGTGTATGAGAAGCAGATGCTCTACCTCTACGTGCTGAGCGG
CATCGGGGGGCTGCTGCTGCTGCTGCTCATTTTCATAGTGCTGTACAAGGTTGGTTTCTTCAAACGGAAC
CTGAAGGAGAAGATGGAGGCTGGCAGAGGTGTCCCGAATGGAATCCCTGCAGAAGACTCTGAGCAGCTGG
CATCTGGGCAAGAGGCTGGGGATCCCGGCTGCCTGAAGCCCCTCCATGAGAAGGACTCTGAGAGTGGTGG
TGGCAAGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG221297 representing NM_002209
Red=Cloning site Green=Tags(s)

MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGAPGEGNSTGSL
YQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCDQNTYLSGLCYLFRQNLQGPM
LQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSD
YVKWKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDII
RYIIGIGKHFQTKESQETLHKFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELS
SSGISADLSRGHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLIGAPLFYGEQR
GGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVAVGAPLEEQGAVYIFNGRHGG
LSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVAVGAESQMIVLSSRPVVDMVTLMSFSPAEIP
VHEVECSYSTSNKMKEGVNITICFQIKSLYPQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIA
VTTSMSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKN
CGEDKKCEANLRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLED
NSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPS
EGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFS
LCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRN
LKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002209
ORF Size 3510 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002209.1, NP_002200.1
RefSeq Size 5133 bp
RefSeq ORF 3513 bp
Locus ID 3683
UniProt ID P20701
Cytogenetics 16p11.2
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, Viral myocarditis
Gene Summary ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte function-associated antigen-1 (LFA-1), which is expressed on all leukocytes. LFA-1 plays a central role in leukocyte intercellular adhesion through interactions with its ligands, ICAMs 1-3 (intercellular adhesion molecules 1 through 3), and also functions in lymphocyte costimulatory signaling. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Anti-ITGAL Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.