Frizzled 2(FZD2) (NM_001466) Human Tagged ORF Clone

CAT#: RG220921

FZD2 (GFP-tagged) - Human frizzled family receptor 2 (FZD2)

Change vector?

  • TrueORF®

USD 629


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Frizzled 2(FZD2) (NM_001466) Human Tagged ORF Clone
Symbol FZD2
Synonyms fz-2; Fz2; fzE2; hFz2
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG220921 representing NM_001466
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCCCCGCAGCGCCCTGCCCCGCCTGCTGCTGCCGCTGCTGCTGCTGCCCGCCGCCGGGCCGGCCC
AGTTCCACGGGGAGAAGGGCATCTCCATCCCGGACCACGGCTTCTGCCAGCCCATCTCCATCCCGCTGTG
CACGGACATCGCCTACAACCAGACCATCATGCCCAACCTTCTGGGCCACACGAACCAGGAGGACGCAGGC
CTAGAGGTGCACCAGTTCTATCCGCTGGTGAAGGTGCAGTGCTCGCCCGAACTGCGCTTCTTCCTGTGCT
CCATGTACGCACCCGTGTGCACCGTGCTGGAACAGGCCATCCCGCCGTGCCGCTCTATCTGTGAGCGCGC
GCGCCAGGGCTGCGAAGCCCTCATGAACAAGTTCGGTTTTCAGTGGCCCGAGCGCCTGCGCTGCGAGCAC
TTCCCGCGCCACGGCGCCGAGCAGATCTGCGTCGGCCAGAACCACTCCGAGGACGGAGCTCCCGCGCTAC
TCACCACCGCGCCGCCGCCGGGACTGCAGCCGGGTGCCGGGGGCACCCCGGGTGGCCCGGGCGGCGGCGG
CGCTCCCCCGCGCTACGCCACGCTGGAGCACCCCTTCCACTGCCCGCGCGTCCTCAAGGTGCCATCCTAT
CTCAGCTACAAGTTTCTGGGCGAGCGTGATTGTGCTGCGCCCTGCGAACCTGCGCGGCCCGATGGTTCCA
TGTTCTTCTCACAGGAGGAGACGCGTTTCGCGCGCCTCTGGATCCTCACCTGGTCGGTGCTGTGCTGCGC
TTCCACCTTCTTCACTGTCACCACGTACTTGGTAGACATGCAGCGCTTCCGCTACCCAGAGCGGCCTATC
ATTTTTCTGTCGGGCTGCTACACCATGGTGTCGGTGGCCTACATCGCGGGCTTCGTGCTCCAGGAGCGCG
TGGTGTGCAACGAGCGCTTCTCCGAGGACGGTTACCGCACGGTGGTGCAGGGCACCAAGAAGGAGGGCTG
CACCATCCTCTTCATGATGCTCTACTTCTTCAGCATGGCCAGCTCCATCTGGTGGGTCATCCTGTCGCTC
ACCTGGTTCCTGGCAGCCGGCATGAAGTGGGGCCACGAGGCCATCGAGGCCAACTCTCAGTACTTCCACC
TGGCCGCCTGGGCCGTGCCGGCCGTCAAGACCATCACCATCCTGGCCATGGGCCAGATCGACGGCGACCT
GCTGAGCGGCGTGTGCTTCGTAGGCCTCAACAGCCTGGACCCGCTGCGGGGCTTCGTGCTAGCGCCGCTC
TTCGTGTACCTGTTCATCGGCACGTCCTTCCTCCTGGCCGGCTTCGTGTCGCTCTTCCGCATCCGCACCA
TCATGAAGCACGACGGCACCAAGACCGAAAAGCTGGAGCGGCTCATGGTGCGCATCGGCGTCTTCTCCGT
GCTCTACACAGTGCCCGCCACCATCGTCATCGCTTGCTACTTCTACGAGCAGGCCTTCCGCGAGCACTGG
GAGCGCTCGTGGGTGAGCCAGCACTGCAAGAGCCTGGCCATCCCGTGCCCGGCGCACTACACGCCGCGCA
TGTCGCCCGACTTCACGGTCTACATGATCAAATACCTCATGACGCTCATCGTGGGCATCACGTCGGGCTT
CTGGATCTGGTCGGGCAAGACGCTGCACTCGTGGAGGAAGTTCTACACTCGCCTCACCAACAGCCGACAC
GGTGAGACCACCGTG


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220921 representing NM_001466
Red=Cloning site Green=Tags(s)

MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAG
LEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEH
FPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSY
LSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPI
IFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSL
TWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHW
ERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRH
GETTV

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001466
ORF Size 1695 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001466.2, NP_001457
RefSeq Size 1983
RefSeq ORF 1698
Locus ID 2535
Cytogenetics 17q21.31
Domains FRI, Frizzled
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Wnt signaling pathway, Melanogenesis, Pathways in cancer, Colorectal cancer, Basal cell carcinoma
Gene Summary Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations