GLS2 (NM_013267) Human Tagged ORF Clone

CAT#: RG212650

GLS2 (GFP-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein

Change vector?

  • TrueORF®

USD 835


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GLS2 (NM_013267) Human Tagged ORF Clone
Symbol GLS2
Synonyms GA; GLS; hLGA; LGA
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG212650 representing NM_013267
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCTCCATGAAGGCTCTGCAGAAGGCCCTGAGCCGGGCTGGCAGTCACTGCGGGCGAGGAGGCTGGG
GTCACCCGAGCCGGAGCCCCCTCCTTGGCGGGGGCGTCCGGCACCACCTCAGTGAGGCCGCGGCGCAGGG
CAGAGAGACGCCACACAGCCACCAGCCGCAGCACCAGGATCATGATTCATCAGAAAGTGGCATGCTGTCC
CGCCTGGGTGATTTGCTCTTTTACACTATTGCTGAAGGACAGGAACGAATCCCTATCCACAAGTTCACCA
CTGCACTAAAGGCCACTGGACTGCAGACATCAGATCCTCGGCTCCGAGACTGCATGAGCGAGATGCACCG
CGTGGTCCAAGAGTCCAGTAGTGGTGGCCTCTTGGACCGAGATCTCTTCCGAAAGTGTGTGAGCAGCAAC
ATTGTGCTCCTGACCCAGGCATTCCGAAAGAAGTTTGTCATTCCTGATTTTGAGGAGTTCACGGGCCATG
TGGATCGCATCTTTGAGGATGTCAAAGAGCTCACTGGAGGCAAAGTGGCAGCCTACATCCCTCAGCTGGC
CAAGTCAAACCCAGACCTGTGGGGTGTCTCCCTGTGCACTGTGGATGGTCAACGGCACTCTGTGGGCCAC
ACAAAGATCCCCTTCTGCCTGCAGTCCTGTGTGAAGCCCCTCACCTATGCCATCTCCATAAGCACCCTAG
GCACTGACTACGTGCACAAGTTTGTGGGCAAAGAGCCAAGTGGCCTGCGCTACAACAAGCTCTCCCTCAA
TGAGGAAGGAATCCCCCATAACCCCATGGTCAATGCTGGTGCCATTGTTGTCAGCTCCCTGATCAAGATG
GACTGTAACAAAGCAGAGAAGTTTGATTTTGTGTTGCAGTATCTCAACAAAATGGCTGGGAATGAATACA
TGGGTTTCAGCAATGCCACATTCCAGTCAGAGAAGGAAACAGGGGATCGGAATTATGCCATCGGCTATTA
TCTCAAGGAAAAGAAGTGCTTTCCTAAGGGGGTGGACATGATGGCTGCCCTTGATCTCTACTTCCAGCTG
TGTTCTGTGGAGGTCACTTGTGAATCAGGCAGTGTCATGGCAGCCACCCTCGCCAACGGTGGGATCTGCC
CCATCACAGGCGAGAGTGTGCTGAGTGCTGAAGCAGTGCGCAACACCCTCAGCCTCATGCATTCCTGCGG
CATGTATGACTTCTCTGGCCAGTTTGCCTTCCACGTGGGCCTGCCAGCCAAGTCAGCTGTATCAGGAGCC
ATCCTCCTGGTGGTACCCAATGTCATGGGAATGATGTGCCTGTCACCCCCATTGGACAAGCTGGGGAACA
GCCATAGGGGGACCAGCTTCTGCCAGAAGTTGGTGTCTCTCTTCAATTTCCACAACTATGACAACCTGAG
GCACTGTGCTCGGAAGTTAGACCCACGGCGTGAAGGGGCAGAAATTCGGAACAAGACTGTGGTCAACCTG
TTATTTGCTGCCTATAGTGGCGATGTCTCAGCTCTTCGAAGGTTTGCCTTGTCAGCCATGGATATGGAAC
AGAAAGACTATGACTCGCGCACAGCTCTGCATGTTGCTGCAGCTGAAGGACACATCGAAGTTGTTAAATT
CCTGATCGAGGCTTGCAAAGTGAATCCTTTTGCCAAGGACAGGTGGGGCAACATTCCCCTGGATGATGCT
GTGCAGTTCAACCATCTGGAGGTGGTCAAACTGCTTCAAGATTACCAGGACTCCTACACACTCTCTGAAA
CTCAGGCTGAGGCAGCAGCTGAGGCCCTGTCCAAAGAGAACTTAGAAAGCATGGTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212650 representing NM_013267
Red=Cloning site Green=Tags(s)

MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDHDSSESGMLS
RLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQESSSGGLLDRDLFRKCVSSN
IVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGH
TKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKM
DCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQL
CSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGAEIRNKTVVNL
LFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIEACKVNPFAKDRWGNIPLDDA
VQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_013267
ORF Size 1806 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013267.2, NP_037399
RefSeq Size 2636
RefSeq ORF 1809
Locus ID 27165
Cytogenetics 12q13.3
Domains ANK, Glutaminase
Protein Pathways Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, D-Glutamine and D-glutamate metabolism, Nitrogen metabolism, Metabolic pathways
Gene Summary The protein encoded by this gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. Originally thought to be liver-specific, this protein has been found in other tissues as well. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations