PPP2R4 (PTPA) (NM_021131) Human Tagged ORF Clone

CAT#: RG212144

  • TrueORF®

PPP2R4 (tGFP-tagged) - Human protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_021131" in other vectors (6)

Reconstitution Protocol

USD 650.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


PTPA rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "PPP2R4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol PPP2R4
Synonyms PP2A; PPP2R4; PR53
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG212144 representing NM_021131
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAGGGCGAGCGGCAGCCGCCGCCAGATTCTTCAGAGGAGGCCCCTCCAGCCACTCAGAACTTCA
TCATTCCAAAAAAGGAGATCCACACAGTTCCAGACATGGGCAAATGGAAGCGTTCTCAGGCATACGCTGA
CTACATCGGATTCATCCTTACCCTCAACGAAGGTGTGAAGGGGAAGAAGCTGACCTTCGAGTACAGAGTC
TCCGAGGCCATTGAGAAACTAGTCGCTCTTCTCAACACGCTGGACAGGTGGATTGATGAGACTCCTCCAG
TGGACCAGCCCTCTCGGTTTGGGAATAAGGCATACAGGACCTGGTATGCCAAACTTGATGAGGAAGCAGA
AAACTTGGTGGCCACAGTGGTCCCTACCCATCTGGCAGCTGCTGTGCCTGAGGTGGCTGTTTACCTAAAG
GAGTCAGTGGGGAACTCCACGCGCATTGACTACGGCACAGGGCATGAGGCAGCCTTCGCTGCTTTCCTCT
GCTGTCTCTGCAAGATTGGGGTGCTCCGGGTGGATGACCAAATAGCTATTGTCTTCAAGGTGTTCAATCG
GTACCTTGAGGTTATGCGGAAACTCCAGAAAACATACAGGATGGAGCCAGCCGGCAGCCAGGGAGTGTGG
GGTCTGGATGACTTCCAGTTTCTGCCCTTCATCTGGGGCAGTTCGCAGCTGATAGACCACCCATACCTGG
AGCCCAGACACTTTGTGGATGAGAAGGCCGTGAATGAGAACCACAAGGACTACATGTTCCTGGAGTGTAT
CCTGTTTATTACCGAGATGAAGACTGGCCCATTTGCAGAGCACTCCAACCAGCTGTGGAACATCAGCGCC
GTCCCTTCCTGGTCCAAAGTGAACCAGGGTCTCATCCGCATGTATAAGGCCGAGTGCCTGGAGAAGTTCC
CTGTGATCCAGCACTTCAAGTTCGGGAGCCTGCTGCCCATCCATCCTGTCACGTCGGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG212144 representing NM_021131
Red=Cloning site Green=Tags(s)

MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRV
SEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLK
ESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVW
GLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISA
VPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG

TRTRPLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021131
ORF Size 969 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021131.5
RefSeq Size 2666 bp
RefSeq ORF 972 bp
Locus ID 5524
UniProt ID Q15257
Cytogenetics 9q34.11
Domains PTPA
Protein Families Druggable Genome, Phosphatase
Gene Summary Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.