CDC26 (NM_139286) Human Tagged ORF Clone

CAT#: RG209719

CDC26 (tGFP-tagged) - Human cell division cycle 26 homolog (S. cerevisiae) (CDC26)

Product Images

Circular map for RG209719

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: CDC26
• Synonyms: ANAPC12; APC12; C9orf17
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG209719 representing NM_139286
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCTGAGACGGAAACCAACACGCCTAGAGCTAAAGCTTGATGACATTGAAGAGTTTGAGAACATTCGAA
  AGGACCTGGAGACCCGTAAGAAACAGAAGGAAGATGTGGAAGTTGTAGGAGGCAGTGATGGAGAAGGAGC
  CATTGGGCTTAGCAGTGATCCCAAGAGCCGGGAACAAATGATCAATGATCGGATTGGTTATAAACCCCAA
  CCCAAGCCCAATAATCGTTCATCTCAATTTGGAAGTCTTGAATTT
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG209719 representing NM_139286
  Red=Cloning site Green=Tags(s)
  
  MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ
  PKPNNRSSQFGSLEF
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_139286
• ORF Size: 255 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_139286.4
• RefSeq Size: 885 bp
• RefSeq ORF: 258 bp
• Locus ID: 246184
• UniProt ID: Q8NHZ8
• Cytogenetics: 9q32
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis
• Gene Summary: The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. [provided by RefSeq, Jul 2008]