Diaph2 (NM_172493) Mouse Tagged ORF Clone

CAT#: MG226708

Diap2 (GFP-tagged) - Mouse diaphanous homolog 2 (Drosophila) (Diap2), (10ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,535.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Diaph2 (NM_172493) Mouse Tagged ORF Clone
Symbol Diaph2
Synonyms Dia3; Diap2; Drf2; E430022I22Rik
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG226708 representing NM_172493
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGCTCGGGGCGGCGGCGTCGGGAGCCGGAGGCGGCGGCGGTGGCGGCGAGGAACACGGCGGGG
GCCGGAGCAACAAGCGAGGCGCGGGGAACCGGGCCGCCAACGAAGAGGAGACGAGAAACAAACCCAAACT
GAACATTCAAATAAAAACTTTGGCAGATGATGTGCGTGACCGAATTACAAGTTTCAGAAAATCTGCCACC
AAGAGAGAAAAGCCTGTTATTCAACATTCTATTGATTATCAAACTGCAGTGGTTGAGATTCCCCCAGCTC
TGATAGTACATGATGACCGATCTTTGATTTTGTCTGAAAAGGAAGTTCTGGACCTCTTTGAGAAAATGAT
GGAAGATATGAACCTTAATGAAGAAAAGAAAGCTCCTTTGCGAAAGAAGGATTTTAGCATCAAGCGTGAG
ATGGTTGTCCAGTATATTTCTGCTACTTCCAAATCTGGTGGCCTGAAAAACAGCAAACATGAGTTCACCC
TTTCTTCACAAGAATATGTTCATGAATTACGATCTGGCATCTCAGATGAGAAACTTCTCAACTGCCTGGA
ATCTTTGAGAGTGTCTTTAACCAGCCATCCTGTCAGCTGGGTCAACAACTTTGGCTATGAAGGACTTGGA
GTCTTACTGGATGTGCTGGAGAAGCTTCTGGACAAAAAACAGCAAGAAAATATCGACAAGAAGAATCAGT
ACAAAGTCATTCAGTGCCTGAAAGCATTTATGAATAATAAGTTTGGACTACAAAGAATTCTAGGAGACGA
GAGAAGCCTTTTACTGTTGGCAAGAGCAATTGACCCGAAACAACAGAATATGATGACTGAAATAGTAAAA
ATCCTTTCTGCTATTTGCATTGTTGGGGAAGAAAACATTCTAGACAAACTTTTAGGGGGCATCACTGCTG
CAGCTGAACTAAATAATAGAGAACGATTTTCACCAATTGTGGAAGGCTTAGAAAATAATGAAGCCTTGCA
TCTCCAGGTGGCCTGCATGCAGTTCATAAATGCACTTGTCACCTCTCCATATGATCTTGATTTTCGAATT
CATTTGAGGAATGAATTCCTTCGTTGTGGATTAAAAGCAATGCTCCCTACTCTTAAAGAGATAGAGAATG
AAGGGCTTGATATTCAGTTGAGAGTGTTTGAAGAGAACAAAGAAGATGACCTAAGTGAATTATCCCACCG
TCTCAATGACATTCGAGCTGAAATGGATGATATTAATGAAGTCTACCATCTGCTGTATAATATGCTGAAG
GACACTGCTGCGGAACCTTACTTATTATCCATTCTCCAACACTTTCTGCTCATCAGAAATGATTACTACA
TCAGGCCACAGTATTATAAAATCATTGAGGAGTGTGTTTCACAGATAGTGCTACACTGCAGTGGCATGGA
CCCAGACTTCAAGTACCGGCAGCGCATAGACTTTGATTTCACTCATCTCCTAGATGCTTGTGTAAATAAG
GCAAAAGTTGAAGAAAATGAGCAAAAAGCAATGGAATTTTCAAAGAAGTTCGATGAAGAATTCACAGCTC
GTCAGGAAGCTCAAGCAGAGCTTCAGAAAAGAGATGAAAAAATCAAAGAACTGGAAACAGAAATCCAGCA
GCTTCGAGGACAGGGAGTTCCATCTGCAATTCCAGGTCCACCTCCACCACCTCCACTGCCAGGTGCAGGA
CCATGCCCACCACCACCACCTCCTCCTCCTCCACCACCTCCACTTCCAGGAGTCGTCCCTCCTCCTCCTC
CACCATTACCTGGGATGCCTGGTATTCCACCACCACCTCCACCACCTTTGTCTGGAGTACCTCCTCCACC
ACCACCCCCTGGGGGAGTTTTTCCTCTCCTATCAGGACCAATTGAGCTACCATATGGAATGAAGCAGAAA
AAATTATATAAGCCTGACATACCTATGAAAAGAATCAACTGGTCCAAGATTGAGCCTAAAGAATTATCCG
AAAACTGTGTTTGGCTAAAACTTAAAGAAGAGAAGTATGAGAATGCAGATCTATTTGCAAAACTGGCCTT
GACATTTCCTTCCCAGATGAAAGGTCAAAGGAATACAGAGGCTGCAGAAGAAAATAGGAGTGGGCCTCCA
AAGAAGAAAGTGAAGGAATTGAGAATTTTGGATACCAAAACAGCCCAGAATCTATCTATCTTCCTTGGAT
CTTACCGCATGCCATACGAGGAAATAAAGAACATTATTTTGGAGGTTAATGAAGAGATGCTCAGTGAGGC
CCTAATCCAGAATCTTGTAAAATATCTTCCTGACCAGAACGCACTCCGAGAACTAGCCCAGCTTAAGAGT
GAATATGATGATCTCTGTGAGCCTGAGCAGTTTGGTGTTGTGATGAGCACGGTGAAAATGTTACGTCCTC
GTCTCACGAGCATCCTTTTCAAACTCACCTTTGAAGAACATGTCAACAACATCAAACCAAGCATCATAGC
AGTAACTCTTGCATGTGAAGAACTGAAGAAAAGTGAAAGCTTTAAGAGACTCTTAGAGTTGATTCTTCTG
GTTGGAAACTACATGAACTCAGGCTCCAGGAATGCCCAGTCTCTAGGTTTTAAGATTAACTTTCTGTGTA
AGATCAAAGACACAAAATCAGCAGATCAAAAATCCACCCTTTTGCATTTTCTTGCTGAAATCTGTGATGA
GAAATACCGGGATATCCTGAAATTTCCTGATGAGCTGGAGCATGTGGAAAGCGCAGGCAAAGTTTCAGCT
CAAATACTCAAGAGCAACCTTGTAGCAATGGAACAAAGCATTCTTCATCTGGAGAAAAACATCAAGAATT
TCCCACCAGCAGAATCGCACCATGATAAGTTTGTGGAAAAGATGATGAGCTTTACCCAGAATGCCAGAGA
ACAGTATGACAAACTGTCCACCATGCACAGCAATATGTTGAAGCTCTATGAGAGTCTGGGAGAATACTTC
ATTTTTGACCCGAACACAGTAAACATGGAAGAATTTTTTGGTGATCTCAACACCTTCAGAACCCTATTTT
TGGAAGCACTGAAAGAAAACCACAAGAGAAAGGAAATGGAAGAGAAGAGCAGGAGAGCAAAGCTTGCAAA
AGAGAAAGCGGAACAAGAGAAGCTGGAACGCCAGAAGAAGAAGAAGCAACTCATTGACATAAACAAAGAG
GGTGATGAGACGGGAGTGATGGATAATCTTCTGGAAGCCCTACAGTCAGGTGCAGCATTCAGAGACCGCA
GAAAGCGAATTCCAAGAAATCCAGATAACAGACGGCCCCCTCTGGAAAGATCTCGCTCTCGCCACAATGG
AGCCATGTCATCCAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG226708 representing NM_172493
Red=Cloning site Green=Tags(s)

MEELGAAASGAGGGGGGGEEHGGGRSNKRGAGNRAANEEETRNKPKLNIQIKTLADDVRDRITSFRKSAT
KREKPVIQHSIDYQTAVVEIPPALIVHDDRSLILSEKEVLDLFEKMMEDMNLNEEKKAPLRKKDFSIKRE
MVVQYISATSKSGGLKNSKHEFTLSSQEYVHELRSGISDEKLLNCLESLRVSLTSHPVSWVNNFGYEGLG
VLLDVLEKLLDKKQQENIDKKNQYKVIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMMTEIVK
ILSAICIVGEENILDKLLGGITAAAELNNRERFSPIVEGLENNEALHLQVACMQFINALVTSPYDLDFRI
HLRNEFLRCGLKAMLPTLKEIENEGLDIQLRVFEENKEDDLSELSHRLNDIRAEMDDINEVYHLLYNMLK
DTAAEPYLLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLHCSGMDPDFKYRQRIDFDFTHLLDACVNK
AKVEENEQKAMEFSKKFDEEFTARQEAQAELQKRDEKIKELETEIQQLRGQGVPSAIPGPPPPPPLPGAG
PCPPPPPPPPPPPPLPGVVPPPPPPLPGMPGIPPPPPPPLSGVPPPPPPPGGVFPLLSGPIELPYGMKQK
KLYKPDIPMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRSGPP
KKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKS
EYDDLCEPEQFGVVMSTVKMLRPRLTSILFKLTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILL
VGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSA
QILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMSFTQNAREQYDKLSTMHSNMLKLYESLGEYF
IFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKE
GDETGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRPPLERSRSRHNGAMSSK

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_172493
ORF Size 3306 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_172493.2, NP_766081
RefSeq Size 8456
RefSeq ORF 3309
Locus ID 54004
Cytogenetics X|X E3
Gene Summary May be involved in oogenesis. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)