Igf2 (NM_010514) Mouse Tagged ORF Clone

CAT#: MG223626

Igf2 (tGFP-tagged) - Mouse insulin-like growth factor 2 (Igf2) transcript variant 1, (10ug)

Product Images

Circular map for MG223626

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Igf2
• Synonyms: AL033362; Igf; Igf-; Igf-2; Igf-II; M; M6; M6pr; Mpr; Peg; Peg2
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG223626 representing NM_010514
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGCGGCAGCGTCGCCGGCTTCCAGGTACCAATGGGGATCCCAGTGGGGAAGTCGATGTTGGTGCTTC
  TCATCTCTTTGGCCTTCGCCTTGTGCTGCATCGCTGCTTACGGCCCCGGAGAGACTCTGTGCGGAGGGGA
  GCTTGTTGACACGCTTCAGTTTGTCTGTTCGGACCGCGGCTTCTACTTCAGCAGGCCTTCAAGCCGTGCC
  AACCGTCGCAGCCGTGGCATCGTGGAAGAGTGCTGCTTCCGCAGCTGCGACCTGGCCCTCCTGGAGACAT
  ACTGTGCCACCCCCGCCAAGTCCGAGAGGGACGTGTCTACCTCTCAGGCCGTACTTCCGGACGACTTCCC
  CAGATACCCCGTGGGCAAGTTCTTCCAATATGACACCTGGAGACAGTCCGCGGGACGCCTGCGCAGAGGC
  CTGCCTGCCCTCCTGCGTGCCCGCCGGGGTCGCATGCTTGCCAAAGAGCTCAAAGAGTTCAGAGAGGCCA
  AACGTCATCGTCCCCTGATCGTGTTACCACCCAAAGACCCCGCCCACGGGGGAGCCTCTTCGGAGATGTC
  CAGCAACCATCAG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG223626 representing NM_010514
  Red=Cloning site Green=Tags(s)
  
  MGGSVAGFQVPMGIPVGKSMLVLLISLAFALCCIAAYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRA
  NRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSQAVLPDDFPRYPVGKFFQYDTWRQSAGRLRRG
  LPALLRARRGRMLAKELKEFREAKRHRPLIVLPPKDPAHGGASSEMSSNHQ
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_010514
• ORF Size: 573 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_010514.3, NP_034644.2
• RefSeq Size: 4038 bp
• RefSeq ORF: 576 bp
• Locus ID: 16002
• UniProt ID: P09535
• Cytogenetics: 7 87.99 cM
• Gene Summary: This gene encodes a member of the insulin-like growth factor (IGF) family of proteins that promote growth and development during fetal and postnatal life. It is an imprinted gene that is expressed only from the paternal allele. The encoded protein undergoes proteolytic processing to generate a mature peptide. The transgenic overexpression of this gene in mice results in prenatal overgrowth, polyhydramnios, fetal and neonatal lethality, disproportionate organ overgrowth including tongue enlargement, and skeletal abnormalities. Mice lacking the encoded protein exhibit growth deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Oct 2015]