Eloc (NM_026456) Mouse Tagged ORF Clone

CAT#: MG221563

Tceb1 (tGFP-tagged) - Mouse transcription elongation factor B (SIII) polypeptide 1 (Tceb1), (10ug)

Product Images

Circular map for MG221563

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Eloc
• Synonyms: 2610043E24Rik; 2610301I15Rik; AA407206; AI987979; AW049146; Tceb1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG221563 representing NM_026456
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGATGGAGAGGAGAAGACCTATGGTGGCTGTGAAGGCCCTGATGCTATGTATGTGAAATTAATATCTT
  CTGATGGCCATGAATTTATTGTAAAAAGAGAACATGCACTAACATCAGGAACAATAAAGGCTATGTTGAG
  TGGTCCAGGTCAGTTTGCTGAGAATGAAACCAACGAGGTCAATTTTAGAGAGATCCCCTCACATGTGCTA
  TCAAAAGTGTGCATGTATTTTACCTACAAGGTCCGCTATACTAACAGCTCCACTGAAATTCCTGAATTCC
  CAATTGCACCTGAAATTGCACTGGAACTGCTGATGGCTGCAAACTTCCTAGATTGT
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG221563 representing NM_026456
  Red=Cloning site Green=Tags(s)
  
  MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVL
  SKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_026456
• ORF Size: 336 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_026456.4, NP_080732.1
• RefSeq Size: 968 bp
• RefSeq ORF: 339 bp
• Locus ID: 67923
• UniProt ID: P83940
• Cytogenetics: 1 A3
• Gene Summary: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (By similarity). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (PubMed:27863225, PubMed:27863226).[UniProtKB/Swiss-Prot Function]