Cdk5r2 (NM_009872) Mouse Tagged ORF Clone

CAT#: MG216908

Cdk5r2 (GFP-tagged) - Mouse cyclin-dependent kinase 5 regulatory subunit 2 (p39) (Cdk5r2), (10ug)

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cdk5r2 (NM_009872) Mouse Tagged ORF Clone
Symbol Cdk5r2
Synonyms B230310J22Rik; p39
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG216908 representing NM_009872
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCACGGTGCTGTCGCTTTCCCCTGCTTCCTCGGCCAAGGGCCGGAGGCCGGGAGGGCTGCCGGAGG
AGAAAAAGAAGGCGCCGCCCGCGGGGGACGAGGCGCTGGGGGGCTACGGCGCGCCGCCGGCCGGCAAGGG
CGGCAAAGGCGAGAGCCGGCTCAAACGGCCGTCCGTGCTCATCTCGGCGCTCACCTGGAAGCGCCTAGTG
GCAGCCTCGGCCAAGAAGAAGAAAGGCAGCAAAAAGGTGACGCCCAAGCCAGCGTCCACCGGTCCCGACC
CTCTGGTCCAGCAACGCAACCGCGAGAACCTTCTCCGCAAGGGCCGCGACGGCCCCGACGGTGGCGGAAC
AGCCAAGCCCCTGGCCGTGCCGGTGCCCACGGTGCCCACGACCGCTGCCACCTGCGAGCCCCCGTCGGGG
GGCAGCGCAGCCGCCCCTCCACCAGGCTCAGGCGGGGGAAAGCCGCCGCCGCCGCCACCCCCAGCCCCGC
AGGCGGCACCGCCGGCGCCCGGAGGCTCGCCGCGGCGGGTCATCGTGCAGGCGTCTACCGGCGAGCTGCT
CCGCTGCCTCGGCGACTTCGTGTGCCGACGCTGCTACCGCCTCAAGGAGCTGAGCCCCGGCGAGCTGGTG
GGCTGGTTCCGCGGCGTGGACCGCTCGCTGCTGCTGCAGGGCTGGCAAGACCAGGCCTTCATTACCCCCG
CCAACCTGGTGTTCGTGTACCTGCTGTGCCGGGAGTCGCTTCGTGGGGACGAGCTGGCGTCGGCCGCGGA
ACTGCAGGCCGCCTTCCTCACCTGCCTCTACCTCGCCTACTCCTACATGGGCAACGAGATCTCCTACCCG
CTCAAGCCGTTCCTCGTGGAGCCCGACAAGGAGCGCTTCTGGCAGCGCTGCCTGCGCCTCATCCAGCGGC
TCAGCCCGCAGATGCTGCGACTCAACGCCGACCCCCACTTCTTCACGCAAGTCTTTCAAGACCTCAAGAA
CGAGGGCGAGGCCGCGGCGAGCACCGGGGGTCCACCGAGCGGAAGCAGCGCGTCCACCACCTCCTCCTCG
AGCGCCAGGGACAGCTGCGCGACCGGAGCCAAGCACTGGACTATGAACTTGGACCGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216908 representing NM_009872
Red=Cloning site Green=Tags(s)

MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPAGKGGKGESRLKRPSVLISALTWKRLV
AASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDGPDGGGTAKPLAVPVPTVPTTAATCEPPSG
GSAAAPPPGSGGGKPPPPPPPAPQAAPPAPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELV
GWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYP
LKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASTGGPPSGSSASTTSSS
SARDSCATGAKHWTMNLDR

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_009872
ORF Size 1107 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_009872.3, NP_034002
RefSeq Size 2704
RefSeq ORF 1110
Locus ID 12570
Cytogenetics 1|1 C4
Gene Summary Activator of CDK5/TPKII. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations