Morf4l1 (BC103783) Mouse Tagged ORF Clone

CAT#: MG204695

  • TrueORF®

Morf4l1 (tGFP-tagged) - Mouse mortality factor 4 like 1 (cDNA clone MGC:118047 IMAGE:6529024)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "BC103783" in other vectors (6)

Reconstitution Protocol

USD 650.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Goat Anti-MRG15 / MORF4L1 Antibody
    • 100 ug

USD 520.00

Other products for "Morf4l1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Morf4l1
Synonyms TEG-189, MRG15, MORFRG15, mKIAA4002
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG204695 representing BC103783
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCCAAGCAGGACCCTAAGCCGAAATTCCAGGAGGGCGAGCGAGTGCTGTGCTTTCATGGGCCTC
TTCTCTATGAAGCAAAGTGTGTAAAGGTTGCCATAAAGGACAAACAAGTGAAATACTTCATCCATTACAG
TGGCTGGAATAAAAATTGGGATGAATGGGTGCCAGAAAGCAGAGTACTCAAATACGTGGACACCAATTTG
CAGAAACAGCGAGAACTTCAAAAGGCCAATCAGGAACAATATGCAGAGGGCAAGATGAGAGGGGCTGCTC
CGGGGAAGAAGACATCCGGCCTGCAACAGAAAAATGTCGAAGTGAAAACAAAAAAGAACAAGCAGAAAAC
ACCTGGAAATGGAGATGGTGGCAGTACCAGTGAGACACCTCAGCCTCCTAGGAAGAAGAGAGCCCGGGTA
GATCCTACCGTTGAAAATGAAGAAACCTTCATGAACAGAGTTGAAGTTAAAGTGAAGATCCCTGAAGAGC
TGAAACCCTGGCTTGTGGATGACTGGGACTTGATCACCAGACAGAAGCAGCTTTTTTATCTTCCTGCCAA
GAAGAATGTGGATTCCATTTTGGAGGATTATGCAAATTATAAGAAGTCTCGAGGAAATACAGATAATAAA
GAGTATGCTGTTAATGAGGTGGTGGCAGGCATAAAGGAGTACTTCAATGTCATGTTGGGCACTCAGCTCC
TCTACAAGTTTGAGAGACCACAGTACGCTGAAATCCTCGCCGACCACCCGGATGCGCCCATGTCCCAGGT
GTACGGAGCGCCACATTTGCTGAGATTATTTGTGCGAATTGGAGCGATGTTGGCCTACACGCCTCTAGAT
GAGAAAAGCCTTGCTTTATTACTGAACTATCTACATGATTTTCTCAAGTACCTGGCGAAGAATTCTGCAA
CCTTGTTCAGTGCCAGTGATTATGAAGTGGCCCCTCCTGAGTACCATCGGAAAGCCGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG204695 representing BC103783
Red=Cloning site Green=Tags(s)

MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL
QKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARV
DPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK
EYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLD
EKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC103783
ORF Size 971 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC103783, AAI03784
RefSeq Size 1301 bp
RefSeq ORF 971 bp
Locus ID 21761
Cytogenetics 9 E3.1
Gene Summary Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.