Hprt (NM_013556) Mouse Tagged ORF Clone

CAT#: MG202453

Hprt (GFP-tagged) - Mouse hypoxanthine guanine phosphoribosyl transferase 1 (Hprt1)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Hprt (NM_013556) Mouse Tagged ORF Clone
Symbol Hprt
Synonyms C81579; HPGRT; Hprt1
Vector pCMV6-AC-GFP
Sequence Data
>MG202453 representing NM_013556
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACCCGCAGTCCCAGCGTCGTGATTAGCGATGATGAACCAGGTTATGACCTAGATTTGTTTTGTA
TACCTAATCATTATGCCGAGGATTTGGAAAAAGTGTTTATTCCTCATGGACTGATTATGGACAGGACTGA
AAGACTTGCTCGAGATGTCATGAAGGAGATGGGAGGCCATCACATTGTGGCCCTCTGTGTGCTCAAGGGG
GGCTATAAGTTCTTTGCTGACCTGCTGGATTACATTAAAGCACTGAATAGAAATAGTGATAGATCCATTC
CTATGACTGTAGATTTTATCAGACTGAAGAGCTACTGTAATGATCAGTCAACGGGGGACATAAAAGTTAT
TGGTGGAGATGATCTCTCAACTTTAACTGGAAAGAATGTCTTGATTGTTGAAGATATAATTGACACTGGT
AAAACAATGCAAACTTTGCTTTCCCTGGTTAAGCAGTACAGCCCCAAAATGGTTAAGGTTGCAAGCTTGC
TGGTGAAAAGGACCTCTCGAAGTGTTGGATACAGGCCAGACTTTGTTGGATTTGAAATTCCAGACAAGTT
TGTTGTTGGATATGCCCTTGACTATAATGAGTACTTCAGGGATTTGAATCACGTTTGTGTCATTAGTGAA
ACTGGAAAAGCCAAATACAAAGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG202453 representing NM_013556
Red=Cloning site Green=Tags(s)

MATRSPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKG
GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTG
KTMQTLLSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISE
TGKAKYKA

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_013556
ORF Size 654 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013556.2, NP_038584
RefSeq Size 1349
RefSeq ORF 657
Locus ID 15452
Cytogenetics X A5|X 29.31 cM
Gene Summary The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. [provided by RefSeq, Sep 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)