Ppdpf (NM_025598) Mouse Tagged ORF Clone

CAT#: MG200479

Ppdpf (GFP-tagged) - Mouse RIKEN cDNA 2700038C09 gene (2700038C09Rik)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 443.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Ppdpf (NM_025598) Mouse Tagged ORF Clone
Symbol Ppdpf
Synonyms 0610012G23Rik; 2610317A05Rik; 2700038C09Rik; 3110053G12Rik
Vector pCMV6-AC-GFP
Sequence Data
>MG200479 representing NM_025598
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCCATCCCTTCCAGCGGCTCGCTCGTGGCTACCCATGACTACTATCGGCGACGCCTGGGCTCCT
CGTCCAGCAGCAGCTCCGGCGGAAGTGCCGAGTACCCTGGGGACGCCGTGCTCCAGTCCCCGGGTCTTCC
CAAAGCCGACCCGGGCCACTGGTGGGCCAGCTTCTTTTTCGGGAAATCCACACTCCCGTTCATGACTACA
GTGTTGGAGTCTCCTGAGCGCTCGGCAGAATCCCCCCAGGTCTCCAGAAGCCCGATGACCTGTGGCCTGA
CTCCTGAAACCATGAAGCAGCAGCCAGTCATCCATTCTGGCCAGACCAACCCCAGGGACCTTTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200479 representing NM_025598
Red=Cloning site Green=Tags(s)

MAAIPSSGSLVATHDYYRRRLGSSSSSSSGGSAEYPGDAVLQSPGLPKADPGHWWASFFFGKSTLPFMTT
VLESPERSAESPQVSRSPMTCGLTPETMKQQPVIHSGQTNPRDLS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_025598
ORF Size 345 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_025598.1, NP_079874
RefSeq Size 798
RefSeq ORF 348
Locus ID 66496
Cytogenetics 2|2 H4
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.