C17orf97 Rabbit Polyclonal Antibody

CAT#: TA357165

C17orf97 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "C17orf97"

Specifications

Product Data
Reactivities Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC
Specificity Expected reactivity: Dog, Horse, Human, Mouse, Rat
Homology: Dog: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 90%
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Stability Shelf life: one year from despatch.
Predicted Protein Size 50 kDa
Gene Name chromosome 17 open reading frame 97
Synonyms C17orf97
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.