PHACS (ACCS) Rabbit Polyclonal Antibody

CAT#: TA346852

Rabbit Polyclonal Anti-PHACS Antibody

Product Images

WB Suggested Anti-PHACS Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHACS antibody: synthetic peptide directed towards the middle region of human PHACS. Synthetic peptide located within the following region: RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: 1-aminocyclopropane-1-carboxylate synthase homolog (inactive)
• Database Link:
  NP_001120691
  Entrez Gene 84680 Human
  UniProt ID Q96QU6
• Background: PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.
• Synonyms: ACS; PHACS
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%