NSUN5C Rabbit Polyclonal Antibody

CAT#: TA346851

Rabbit Polyclonal Anti-NSUN5C Antibody

Product Images

WB Suggested Anti-NSUN5C Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate; NSUN5P2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NSUN5C antibody: synthetic peptide directed towards the middle region of human NSUN5C. Synthetic peptide located within the following region: PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Database Link:
  NP_115534
  Entrez Gene 260294 Human
• Background: This locus represents a transcribed pseudogene of a nearby locus on chromosome 7, which encodes a putative methyltransferase. There is also a third closely related pseudogene locus in this region. There is extensive alternative splicing at this locus. [provided by RefSeq, Jul 2013]
• Synonyms: DKFZp434K058; DKFZp666P104; FLJ11626; member 5C; MGC15057; MGC129801; NOL1; NOL1R2; NOP2; Sun domain family; WBSCR20B; WBSCR20C; Williams Beuren syndrome chromosome region 20C
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%