Pggt1b Rabbit Polyclonal Antibody

CAT#: TA346734

Rabbit Polyclonal Anti-Pggt1b Antibody

Product Images

Host: Rabbit; Target Name: Pggt1b; Sample Tissue: Rat Small Intestine lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Pggt1b antibody is: synthetic peptide directed towards the C-terminal region of Rat Pggt1b. Synthetic peptide located within the following region: HAYFGICGLSLMEESGICKVHPALNVSTRTSERLRDLHQSWKTKDSKQCS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: protein geranylgeranyltransferase type 1 subunit beta
• Database Link:
  NP_112344
  Entrez Gene 81746 Rat
  UniProt ID P53610
• Background: catalyzes the transfer of a geranylgeranyl group to the cysteine residue of proteins containing a carboxyl-terminal CAAX where X is preferably leucine [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: L24116.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
• Synonyms: BGGI; GGTase-I-beta; GGTI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%