Transglutaminase 3 (TGM3) Rabbit Polyclonal Antibody

CAT#: TA346349

Rabbit Polyclonal Anti-TGM3 Antibody

Product Images

WB Suggested Anti-TGM3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TGM3 antibody: synthetic peptide directed towards the N terminal of human TGM3. Synthetic peptide located within the following region: MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: transglutaminase 3
• Database Link:
  NP_003236
  Entrez Gene 7053 Human
  UniProt ID Q08188
• Background: Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites
• Synonyms: TGE
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome