SIGLEC6 Rabbit Polyclonal Antibody

CAT#: TA346279

Rabbit Polyclonal Anti-SIGLEC6 Antibody

Product Images

WB Suggested Anti-SIGLEC6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: SIGLEC6; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the N terminal of human SIGLEC6. Synthetic peptide located within the following region: VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: sialic acid binding Ig like lectin 6
• Database Link:
  NP_001236
  Entrez Gene 946 Human
  UniProt ID O43699
• Background: SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
• Synonyms: CD33L; CD33L1; CD33L2; CD327; CDW327; OBBP1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Horse: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane