KIAA0859 (METTL13) Rabbit Polyclonal Antibody

CAT#: TA346244

Rabbit Polyclonal Anti-KIAA0859 Antibody

Product Images

WB Suggested Anti-KIAA0859 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIAA0859 antibody: synthetic peptide directed towards the C terminal of human KIAA0859. Synthetic peptide located within the following region: NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: methyltransferase like 13
• Database Link:
  NP_001007240
  Entrez Gene 51603 Human
  UniProt ID Q8N6R0
• Background: The function remains unknown.
• Synonyms: 5630401D24Rik; CGI-01; feat; KIAA0859
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome