LDB3 Rabbit Polyclonal Antibody

CAT#: TA346123

Rabbit Polyclonal Anti-LDB3 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of LIM domain binding 3 (LDB3), transcript variant 3
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Purified recombinant protein of Homo sapiens LIM domain binding 3 (LDB3), transcript variant 3, 20 µg
    • 20 ug

USD 867.00

Other products for "LDB3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LDB3 antibody: synthetic peptide directed towards the N terminal of human LDB3. Synthetic peptide located within the following region: PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name LIM domain binding 3
Background LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.
Synonyms CMD1C; CMPD3; CYPHER; LDB3Z1; LDB3Z4; LVNC3; MFM4; ORACLE; PDLIM6; ZASP
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.