Myoglobin (MB) Rabbit Polyclonal Antibody

CAT#: TA346112

Rabbit Polyclonal Anti-MB Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human myoglobin (MB), transcript variant 1, 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of myoglobin (MB), transcript variant 2
    • 100 ug

USD 436.00

Other products for "Myoglobin"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MB antibody: synthetic peptide directed towards the N terminal of human MB. Synthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 17 kDa
Gene Name myoglobin
Background This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.
Synonyms myoglobgin; PVALB
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 86%; Goat: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 85%; Dog: 79%; Rat: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.