SLC22A8 Rabbit Polyclonal Antibody

CAT#: TA346106

Rabbit Polyclonal Anti-SLC22A8 Antibody

Product Images

WB Suggested Anti-SLC22A8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC22A8 antibody: synthetic peptide directed towards the middle region of human SLC22A8. Synthetic peptide located within the following region: PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: solute carrier family 22 member 8
• Database Link:
  NP_004245
  Entrez Gene 9376 Human
  UniProt ID Q8TCC7
• Background: SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: OAT3
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Rabbit: 86%; Dog: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane