HCM (RNMT) Rabbit Polyclonal Antibody

CAT#: TA345859

Rabbit Polyclonal Anti-RNMT Antibody

Product Images

WB Suggested Anti-RNMT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNMT antibody: synthetic peptide directed towards the N terminal of human RNMT. Synthetic peptide located within the following region: ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: RNA guanine-7 methyltransferase
• Database Link:
  NP_003790
  Entrez Gene 8731 Human
  UniProt ID O43148
• Background: RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.
• Synonyms: cm1p; CMT1; CMT1c; hCMT1; hMet; MET; Met; RG7MT1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%; Horse: 79%; Rabbit: 79%