OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ISG20 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA345796
Rabbit Polyclonal Anti-ISG20 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY419473 Transient overexpression lysate of interferon stimulated exonuclease gene 20kDa (ISG20) (as WB positive control) 100 ug
$436.00
TP303178 Recombinant protein of human interferon stimulated exonuclease gene 20kDa (ISG20), 20 µg
20 ug
$867.00

View other "ISG20 or NM_002201" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ISG20 antibody: synthetic peptide directed towards the N terminal of human ISG20. Synthetic peptide located within the following region: GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 20 kDa
Gene Name interferon stimulated exonuclease gene 20kDa
Database Link
Background ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
Synonyms CD25; HEM45
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products