ZNF25 Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "ZNF25"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF25 antibody: synthetic peptide directed towards the C terminal of human ZNF25. Synthetic peptide located within the following region: EKPYACKECGKSFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQLTAH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 40 kDa |
Gene Name | zinc finger protein 25 |
Database Link | |
Background | ZNF25 contains 1 KRAB domain and 12 C2H2-type zinc fingers. ZNF25 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Synonyms | KOX19; Zfp9 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 85%; Dog: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.