ADAMTS19 Rabbit Polyclonal Antibody

CAT#: TA345497

Rabbit Polyclonal Anti-ADAMTS19 Antibody

Product Images

WB Suggested Anti-ADAMTS19 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADAMTS19 antibody: synthetic peptide directed towards the N terminal of human ADAMTS19. Synthetic peptide located within the following region: MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 100 kDa
• Gene Name: ADAM metallopeptidase with thrombospondin type 1 motif 19
• Database Link:
  NP_598377
  Entrez Gene 171019 Human
  UniProt ID Q8TE59
• Background: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS16, another family member.
• Synonyms: FLJ16042
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 86%; Rat: 77%

Reference Data

• Protein Families: Protease, Secreted Protein