DCDC2 Rabbit Polyclonal Antibody

CAT#: TA345033

Rabbit Polyclonal Anti-DCDC2 Antibody - N-terminal region


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of doublecortin domain containing 2 (DCDC2)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human doublecortin domain containing 2 (DCDC2), 20 µg
    • 20 ug

USD 867.00

Other products for "DCDC2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Dcdc2a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QIESGGNYVAGGPEAFKKLNYLDIGEIKKRPMEAVNTEVKPVIHSRINVS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name doublecortin domain containing 2
Background This gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization.
Synonyms DCDC2A; NPHP19; RU2; RU2S
Note Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.