CDK5RAP1 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of CDK5 regulatory subunit associated protein 1 (CDK5RAP1), transcript variant 1
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "CDK5RAP1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Rat |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Cdk5rap1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 65 kDa |
Gene Name | CDK5 regulatory subunit associated protein 1 |
Database Link | |
Background | Cdk5rap1 is a probable regulator of CDK5 activity. It may inhibit CDK5 function via its interaction with CDK5R1. |
Synonyms | C20orf34; C42; CGI-05; HSPC167 |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.