CDK5RAP1 Rabbit Polyclonal Antibody

CAT#: TA345026

Rabbit Polyclonal Anti-CDK5RAP1 Antibody - C-terminal region

Product Images

WB Suggested Anti-Cdk5rap1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Cdk5rap1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: CDK5 regulatory subunit associated protein 1
• Database Link:
  NP_057492
  Entrez Gene 51654 Human
  UniProt ID Q96SZ6
• Background: Cdk5rap1 is a probable regulator of CDK5 activity. It may inhibit CDK5 function via its interaction with CDK5R1.
• Synonyms: C20orf34; C42; CGI-05; HSPC167
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 79%