ASXL2 Rabbit Polyclonal Antibody

CAT#: TA344889

Rabbit Polyclonal Anti-ASXL2 Antibody - middle region

Product Images

WB Suggested Anti-ASXL2 Antibody Titration: 0.2-1 ug/ml; Positive Control: NCI-H226 cell lysateASXL2 is supported by BioGPS gene expression data to be expressed in NCIH226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASXL2 antibody: synthetic peptide directed towards the middle region of human ASXL2. Synthetic peptide located within the following region: EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 154 kDa
• Gene Name: additional sex combs like 2, transcriptional regulator
• Database Link:
  NP_060733
  Entrez Gene 55252 Human
  UniProt ID Q76L83
• Background: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax (see MIM 159555) and polycomb (see MIM 610231) (ETP) gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing (Katoh and Katoh, 2003 [PubMed 12888926]).
• Synonyms: ASXH2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%