Lipoamide Dehydrogenase (DLD) Rabbit Polyclonal Antibody

CAT#: TA344335

Rabbit Polyclonal Anti-DLD Antibody - middle region

Product Images

DLD antibody - middle region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.

• 

  2Hum. Adult Placenta; Host: Rabbit; Target Name: SERPINA3; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-DLD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysateDLD is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  4Human MCF7; Host: Rabbit; Target Name: NOP56; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml; DLD is supported by BioGPS gene expression data to be expressed in MCF7

• 

  5Human Hela; Host: Rabbit; Target Name: EGFL8; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml; DLD is supported by BioGPS gene expression data to be expressed in HeLa

• 

  Rabbit Anti-DLD Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Seconda

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: dihydrolipoamide dehydrogenase
• Database Link:
  NP_000099
  Entrez Gene 298942 RatEntrez Gene 1738 Human
  UniProt ID P09622
• Background: DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.This gene encodes the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: DLDD; DLDH; E3; GCSL; LAD; PHE3
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Zebrafish: 93%; Guinea pig: 93%; Mouse: 86%; Yeast: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Citrate cycle (TCA cycle), Glycine, serine and threonine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pyruvate metabolism, Valine, leucine and isoleucine degradation