HNRPH1 (HNRNPH1) Rabbit Polyclonal Antibody

CAT#: TA344321

Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region

Product Images

Lanes : Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysate; Primary Antibody Dilution : 1:4000; Secondary Antibody : Anti-rabbit-HRP; Secondary Antibody Dilution : 1:5000; Gene Name : HNRPH1; Submitted by : Anonymous.HNRNPH1 is

• 

  Host: Rabbit; Target Name: HNRNPH1; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml; HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: HNRNPH1; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: HNRNPH1; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  WB Suggested Anti-HNRPH1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysateHNRNPH1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  IHC Information: Paraffin embedded testis tissue, tested with an antibody Dilution of 5 ug/ml.

• Sample Type : MCF7 cells; Primary Antibody Dilution : 1:200; Secondary Antibody: Anti-rabbit-FITC; Secondary Antibody Dilution: 1:500; Color/Signal Descriptions: DAPI: Blue HNRNPH1: Green; Gene Name: HNRPH1; Submitted by: Anonymous.HNRNPH1 is strongly sup

• Amount and Sample Type : Lane 1: 5% InputLane 2: 5% SupLane 3: Normal IgGLane 4: hn-RNPH1 ppt. k562 sample; IP Antibody : HNRPH1; Amount of IP Antibody : Primary Antibody : HNRPH1; Primary Antibody Dilution: 1:4000; Secondary Antibody : Anti-rabbit-HRP; S

Show all 8 images

Specifications

Product Data

• Applications: IF, IHC, IP, WB
• Recommended Dilution: IF, IP, WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein H1 (H)
• Database Link:
  NP_005511
  Entrez Gene 3187 Human
  UniProt ID P31943
• Background: HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: hnRNPH; HNRPH; HNRPH1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%