AKR1B10 Rabbit Polyclonal Antibody

CAT#: TA344167

Rabbit Polyclonal Anti-AKR1B10 Antibody

Product Images

WB Suggested Anti-AKR1B10 Antibody Titration: 1.25 ug/ml; Positive Control: A549 cell lysate; AKR1B10 is supported by BioGPS gene expression data to be expressed in A549

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AKR1B10 antibody: synthetic peptide directed towards the N terminal of human AKR1B10. Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: aldo-keto reductase family 1, member B10 (aldose reductase)
• Database Link:
  NP_064695
  Entrez Gene 57016 Human
  UniProt ID O60218
• Background: AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
• Synonyms: AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Rabbit: 100%; Zebrafish: 100%; Rat: 93%; Bovine: 93%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Fructose and mannose metabolism, Linoleic acid metabolism, Metabolic pathways