Esrp2 Rabbit Polyclonal Antibody

CAT#: TA344141

Rabbit Polyclonal Anti-Esrp2 Antibody

Product Images

WB Suggested Anti-Esrp2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Esrp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: epithelial splicing regulatory protein 2
• Database Link:
  NP_789808
  Entrez Gene 77411 Mouse
  UniProt ID Q8K0G8
• Background: Esrp2 is an mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. It specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. It also regulates the splicing of CD44, CTNND1, ENAH, 3 transcripts that undergo changes in splicing during the epithelial-to-mesenchymal transition (EMT). It acts by directly binding specific sequences in mRNAs and binds the GU-rich sequence motifs in the ISE/ISS-3, a cis-element regulatory region present in the mRNA of FGFR2.
• Synonyms: FLJ21918; FLJ22248; RBM35B
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Zebrafish: 92%