LARP1 Rabbit Polyclonal Antibody

CAT#: TA343965

Reviews ()
Write a review

Rabbit Polyclonal Anti-LARP1 Antibody



USD 539.00

5 Days*

Size
    • 100 ul

Product images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "LARP1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LARP1 antibody: synthetic peptide directed towards the N terminal of human LARP1. Synthetic peptide located within the following region: MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 123 kDa
Gene Name La ribonucleoprotein domain family member 1
Background LARP1 belongs to the LARP family and it contains 1 HTH La-type RNA-binding domain. The exact function of LARP1 remains unknown.
Synonyms KIAA0731; la related protein; La ribonucleoprotein domain family; LARP; member 1; MGC19556
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Mouse: 86%
Reference Data
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.