CDKN1A interacting zinc finger protein 1 (CIZ1) Rabbit Polyclonal Antibody

CAT#: TA343682

Rabbit Polyclonal Anti-CIZ1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of CDKN1A interacting zinc finger protein 1 (CIZ1), transcript variant 1
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human CDKN1A interacting zinc finger protein 1 (CIZ1), transcript variant 1, 20 µg
    • 20 ug

USD 867.00

Other products for "CDKN1A interacting zinc finger protein 1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CIZ1 antibody: synthetic peptide directed towards the C terminal of human CIZ1. Synthetic peptide located within the following region: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 100 kDa
Gene Name CDKN1A interacting zinc finger protein 1
Background CIZ1 may regulate the subcellular localization of CIP/WAF1.
Synonyms LSFR1; NP94; ZNF356
Note Immunogen Sequence Homology: Human: 100%; Horse: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.