PLAGL1 Rabbit Polyclonal Antibody

CAT#: TA343632

Rabbit Polyclonal Anti-PLAGL1 Antibody

Product Images

WB Suggested Anti-PLAGL1 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate. PLAGL1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLAGL1 antibody: synthetic peptide directed towards the N terminal of human PLAGL1. Synthetic peptide located within the following region: MATHSPQKSHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: PLAG1 like zinc finger 1
• Database Link:
  NP_002647
  Entrez Gene 5325 Human
  UniProt ID Q9UM63
• Background: PLAGL1 is a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate.This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: LOT1; ZAC; ZAC1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors