LBX1 Rabbit Polyclonal Antibody

SKU
TA343621
Rabbit Polyclonal Anti-LBX1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LBX1 antibody: synthetic peptide directed towards the N terminal of human LBX1. Synthetic peptide located within the following region: DHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 30 kDa
Gene Name ladybird homeobox 1
Database Link
Background LBX1 is the transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.
Synonyms homeobox; HPX-6; HPX6; LBX1H
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 92%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:LBX1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.