ZNF239 Rabbit Polyclonal Antibody

CAT#: TA343555

Rabbit Polyclonal Anti-ZNF239 Antibody

Product Images

WB Suggested Anti-ZNF239 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF239 antibody: synthetic peptide directed towards the N terminal of human ZNF239. Synthetic peptide located within the following region: MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: zinc finger protein 239
• Database Link:
  NP_005665
  Entrez Gene 8187 Human
  UniProt ID Q16600
• Background: ZNF239 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZNF239 may be involved in transcriptional regulation.
• Synonyms: HOK-2; MOK2
• Note: Immunogen Sequence Homology: Human: 100%; Goat: 77%

Reference Data

• Protein Families: Transcription Factors