CBFA2T3 Rabbit Polyclonal Antibody

CAT#: TA343514

Rabbit Polyclonal Anti-CBFA2T3 Antibody

Product Images

WB Suggested Anti-CBFA2T3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate; CBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CBFA2T3 antibody: synthetic peptide directed towards the N terminal of human CBFA2T3. Synthetic peptide located within the following region: MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: CBFA2/RUNX1 translocation partner 3
• Database Link:
  NP_005178
  Entrez Gene 863 Human
  UniProt ID O75081
• Background: The t(16;21)(q24;q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of CBFA2T3. In addition, CBFA2T3 is a putative breast tumor suppressor.
• Synonyms: ETO2; MTG16; MTGR2; ZMYND4
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors