ZNF76 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 76 (expressed in testis) (ZNF76)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "ZNF76"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF76 antibody: synthetic peptide directed towards the N terminal of human ZNF76. Synthetic peptide located within the following region: LSDGTTAYVQQAVKGEKLLEGQVIQLEDGTTAYIHQVTVQKEALSFEDGQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 62 kDa |
Gene Name | zinc finger protein 76 |
Database Link | |
Background | ZNF76 belongs to the krueppel C2H2-type zinc-finger protein family. ZNF76 is a general transcription repressor targeting TATA-binding protein (TBP), through a process regulated by sumoylation. ZNF76 interacts with TBP through both its N and C termini, and both regions are required for ZNF76 to exert its inhibitory function on p53-mediated transactivation. As a TBP-interacting transcriptional modulator, ZNF76 is also regulated by alternative splicing. |
Synonyms | D6S229E; Zfp523; ZNF523 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.